Research Article
Conserved Epitope Mapping of Potato Virus Y for Broad-Spectrum Antigen Design: Implications for Plant Immune Recognition and Diagnostic Innovation
Aya Hossameldien Abo-Zaid1*, Medhat Kamel Ali1, Atef Shoukry Sadik2 and Allam Arafat Megahed3
1Department of Plant Pathology, Faculty of Agriculture, Ain Shams University, P.O. Box 68, Hadayek Shobra 11241, Cairo, Egypt; 2Department of Agricultural Microbiology, Laboratory of Virology, Faculty of Agriculture, Ain Shams University, P.O. Box 68, Hadayek Shobra, Cairo, Egypt; 3Agricultural Botany Department (Plant Pathology), Faculty of Agriculture, Damietta University, New Damietta (P.B. 34517), Egypt.
Abstract | Potato virus Y (PVY) is a major plant pathogen affecting solanaceous crops, particularly potato and tomato, leading to significant economic losses. The viral coat protein (CP) is essential for virion stability, host interactions, and immune recognition. Identifying conserved and variable epitopes within the PVY CP provides insights into viral evolution, host adaptation, and potential targets for disease control. This study aimed to investigate the conservation and sequence variability of key PVY CP epitopes across diverse geographic locations and host species. By analyzing the epitope sequences, this study identified the conserved regions suitable for diagnostic tools and the variations indicative of viral adaptation. A comparative sequence analysis of PVY strains from different regions was conducted. Multiple sequence alignments determined identity percentages, conserved motifs, and variations in epitopes, including PVY-CP-A, -D, -F, -G, -H, and -I. Most epitopes exhibited high conservation. PVY-CP-A showed 100 % identity in most strains, with slight variations (91.67 %) in a Greek isolate. PVY-CP-D and -F were largely conserved, with minor variations (87.50 %) recorded in Poland and Bangladesh. PVY-CP-G displayed reduced identity (83.33%) in Poland, China, and Bangladesh, suggesting adaptation. PVY-CP-H was completely conserved, reinforcing its structural importance. PVY-CP-I showed the highest conservation, with minor variations in the UK and China. These findings highlight the conserved PVY epitopes as potential targets for universal diagnostic tools and control strategies. Minor variations suggest regional adaptations, influencing pathogenicity, and host interactions. This study provides valuable insights into PVY evolution, aiding in improved virus detection and diagnosis development.
Received | May 16, 2025; Revised | July 15, 2025; Accepted | August 02, 2025; Published | August 23, 2025
*Correspondence | Aya Hossameldien Abo-Zaid, Department of Plant Pathology, Faculty of Agriculture, Ain Shams University, P.O. Box 68, Hadayek Shobra 11241, Cairo, Egypt; Email: [email protected]
Citation | Abo-Zaid, A.H., M.K. Ali, A.S. Sadik and A.A. Megahed. 2025. Conserved epitope mapping of potato virus Y for broad-spectrum antigen design: Implications for plant immune recognition and diagnostic innovation. Novel Research in Microbiology Journal, 9(4): 332-348.
DOI | https://dx.doi.org/10.17582/journal.NRMJ/2025/9.4.332.348
Keywords | Coat protein, Diagnostic tools, Conserved epitope, Potato virus Y (PVY), Diagnosis development
Copyright: 2025 by the authors. Licensee ResearchersLinks Ltd, England, UK.
This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Introduction
Potato virus Y (PVY) is one of the most economically damaging viruses affecting potato crops worldwide. Belonging to the Potyviridae family, PVY is transmitted primarily by aphids in a non-persistent manner, which significantly increases its spread in agricultural fields (Ali, 2024; Li et al., 2025). PVY infects not only potatoes but also a wide variety of other Solanaceous plants, causing high yield losses and quality deterioration (Kassim et al., 2014; Berindean et al., 2024; Dupuis et al., 2024). The virus’s genetic diversity and ability to adapt to different environmental conditions and host plants make it particularly challenging to control (Verma et al., 2016; Rushton et al., 2024). Resistance strategies based on chemical control, crop rotation, or breeding resistant varieties have had limited success, primarily due to the virus’s rapid mutation rate and ability to evolve resistance to the conventional management practices (Bai et al., 2019; Zhang et al., 2023). Consequently, there has been growing interest in using alternative strategies, such as the development of plant vaccines or immune-based therapies, to combat PVY infections in agricultural settings (Anikina et al., 2023; Lee et al., 2023).
The viral coat protein (CP) of PVY plays a central role in the virus’s lifecycle. It encapsulates the viral RNA genome, protecting it from degradation, facilitates the virus’s movement within the host plant, and its transmission by aphids (Bhoi et al., 2022; Machado-Assefh et al., 2023; Pitt et al., 2024). Beyond its structural role, the CP is a major target for the host’s immune system, eliciting both humoral and cellular immune responses. The viral CP is highly immunogenic, as it can stimulate the production of antibodies and activate the T-cells that recognize viral peptides presented by major histocompatibility complex (MHC) molecules (Lindbo and Falk, 2017; Sheibani et al., 2023; Sheibani et al., 2024). However, PVY, like many other plant viruses, has evolved several mechanisms to evade immune detection, thus complicating efforts are needed to mount a robust and effective immune response (Liu et al., 2017). Understanding the specific epitopes within the PVY CP that are recognized by the immune system is crucial for developing strategies to overcome this immune evasion.
Epitopes are the specific regions of a protein that are recognized by the immune system, particularly by the T-cells and antibodies. The viral CP, being the most exposed part of the virus, is a key candidate for identifying such epitopes. Several studies on other plant viruses demonstrated that viral CP often harbors conserved epitopes that can be targeted for immune intervention (Cuevas et al., 2012). In PVY, these epitopes are likely to play a pivotal role in modulating the immune response, and their identification could provide valuable insights into how the virus interacts with its host and evades immune surveillance (Tian et al., 2014; Belabess et al., 2024). Furthermore, identifying these epitopes is not only important for understanding the virus’s immune evasion mechanisms but also for the development of targeted vaccine strategies, enhancing immune recognition of the virus and preventing infection.
While various epitopes of viral proteins have been identified in related plant viruses, limited studies have comprehensively mapped the immune epitopes within the PVY CP. A previous study has suggested that the PVY CP contains regions capable of binding to MHC molecules, which could trigger the T-cell responses (Rosendahl et al., 2014). Other studies have pointed to the importance of small peptide sequences, ranging from 8 to 15 amino acids in binding to MHC class I and class II molecules, triggering both cellular and humoral immune responses (Afridi et al., 2016; Rock et al., 2016; Rich and Chaplin, 2019). However, the full spectrum of immune-dominant epitopes within the PVY CP remains largely unexplored.
In this context, identifying and characterizing these epitopes from the PVY CP could pave the way for the development of epitope-based vaccines and other therapeutic strategies. Peptide-based vaccines are gaining attention due to their ability to target specific regions of a pathogen, minimizing the risk of immune evasion and providing a more precise immune response (Malonis et al., 2019; Nimisha et al., 2024). These vaccines can stimulate both humoral and cellular immune responses, with potential applications not only in plant pathology but also in broader antiviral vaccine development. Additionally, identifying epitopes that bind to MHC molecules could provide insights into how PVY evades immune detection and how this evasion might be overcome using immunotherapy.
Furthermore, advances in computational tools have made it possible to predict the binding affinities of viral peptides to host MHC molecules, greatly accelerating the identification of potential vaccine candidates (Croft et al., 2019). By combining experimental and computational methods, it is now possible to more accurately identify and characterize immunodominant epitopes and design vaccines that could effectively combat PVY infection. However, for these vaccines to be effective, further validation is required to confirm the ability of the identified epitopes to induce immune responses in vivo and their capacity to bind to MHC molecules (Kreiter et al., 2015).
PVY is one of the most economically significant viral pathogens affecting potato crops worldwide, with a wide range of strains and evolving variants that complicate effective detection and management. Traditional virus purification techniques used to produce antisera for diagnostic applications are often time-consuming, labor-intensive, and yield limited antigen quantities (Lacomme and Jacquot, 2017; Chikh-Ali and Karasev, 2023). In this context, the epitope-based strategies offer a promising alternative for generating broad-spectrum diagnostic tools.
The objective of the present study was to identify conserved epitopes within the PVY CP across a wide range of global isolates. The most immunodominant and conserved epitopes were selected for synthetic peptide production, with the goal of developing an efficient and scalable antigen suitable for generating PVY-specific polyclonal antibodies. Such an approach not only enhances serological detection across multiple PVY strains but also provides insights into viral structural conservation and potential plant immune interactions.
Materials and Methods
Viral strains and plant materials
Potato virus Y (PVY) strains originating from diverse geographic regions and host species were collected, including isolates from Egypt (QKI29299.1), Kazakhstan (QGR25617.1), Turkey (CAC19617.1), Poland (AIA59688.1, AIA59686.1, and AIA59685.1), China (AGU99182.1, AGU99163.1, and AGU99138.1), and other countries. Host plants, including potato and tomato, were used to propagate PVY isolates under controlled greenhouse conditions.
Sequence retrieval and epitope prediction
Potato virus CP sequences from various geographic isolates were retrieved from GenBank (https://www.ncbi.nlm.nih.gov/protein/). Potential epitopes were predicted using an immune epitope prediction tools such as IEDB (Bepipred Linear Epitope Prediction 2.0 (Vita et al., 2019) based on the CP sequences.
Epitopes analysis
The identified epitopes were compared across the PVY strains to assess their conservation and sequence variability. The analysis focused on amino acid identity percentages and variations in specific regions. The sequences were aligned using multiple sequence alignment tools (blastp, protein-protein BLAST, (https://blast.ncbi.nlm.nih.gov/Blast.cgi) to identify conserved and variable regions within key epitopes (PVY-CP-A, -D, -F, -G, -H, and -I).
Phylogenetic analysis
A phylogenetic tree was constructed based on the aligned PVY sequences using MEGA (Molecular Evolutionary Genetics Analysis) software (https://blast.ncbi.nlm.nih.gov/Blast.cgi). This tree was used to assess the genetic relationship among the different PVY strains and identify the potential evolutionary patterns in the epitopes.
Data interpretation
The obtained results were interpreted to determine the functional significance of an epitope conservation and variability. The implications for diagnostic tool development, PVY vaccine design, and future PVY management strategies were discussed.
Results
Identification of epitopes
In this study, several CP epitopes from the viral genome of PVY were identified and characterized, which were crucial for understanding the virus’s immune recognition and potential for vaccine development. The identified epitopes, derived from various regions of the viral CP, are listed in Table 1, where each entry represents a unique peptide sequence with its corresponding length.
The identified epitopes spanned a range of lengths ranging from a single amino acid (e.g., peptide 3: “I”) to 84 amino acids (peptide 1). This diversity in length suggested that the viral CP contained regions
Table 1: Coat protein epitopes of Potato Virus Y (AAM81207.1) and their corresponding peptide sequences and lengths.
|
No. of protein epitopes |
Codes |
Start |
End |
Peptide |
Length amino acids |
|
1 |
A |
5 |
88 |
IDAGGSSKKDARPEQGSIQSNPNKGKDKDVN-AGTSGTHTVPRIKAITSKMRMPTSKGATVLN-LEHLLEYAPQQIDISNTRATQS |
84 |
|
2 |
B |
90 |
92 |
FDT |
3 |
|
3 |
C |
103 |
103 |
I |
1 |
|
4 |
D |
123 |
130 |
GTSPNVNG |
8 |
|
5 |
E |
139 |
141 |
EQV |
3 |
|
6 |
F |
172 |
181 |
EMRNKKEPYM |
10 |
|
7 |
G |
187 |
193 |
IRNLRDM |
7 |
|
8 |
H |
206 |
211 |
TSRTPV |
6 |
|
9 |
I |
238 |
263 |
GISTQEENTERHTTEDVSPSMHTLLG |
26 |
with varying degrees of immunogenicity, which may interact differently with the host immune system. The longest epitope (peptide 1) included a stretch of amino acids from position 5 to 88 and could be a key target for immune responses, given that its substantial size and possible structural conformation may enhance its ability to bind to the major histocompatibility complex (MHC) molecules.
Conservation of PVY coat protein epitopes across regions and hosts
The data presented in this study highlight the identity percentages of amino acid sequences of various epitopes derived from the PVY CP of an Egyptian strain, compared to capsid proteins from different geographic regions and hosts. The results indicated a high degree of conservation for most of the epitopes, with the majority of sequences exhibiting 100 % identity across the different countries and the host plants. This suggests that the regions of the PVY CP under investigation, including Epitope-A, Epitope-D, Epitope-F, Epitope-G, Epitope-H, and Epitope-I were highly conserved across the diverse geographic regions and host species, such as potato and tomato. While most sequences exhibited perfect identity, few strains showed minor variations, particularly in Epitope-G and Epitope-I, where the identity percentages dropped slightly (83.33 % and 96.15 %, respectively).
Sequence variability in the PVY epitope regions
PVY-CP-A epitope
The identities of the PVY-CP-A epitope sequences ranged from 91.67 % to 100 % across the tested samples (Table 2, Figure 1). The majority of sequences exhibited 100 % identity, including those from Egypt, Poland, China, Germany, South Africa, Kazakhstan, and Iran. Some sequences, particularly from Poland, China, and Jordan, showed slightly reduced identity percentages (98.81 %), while the lowest percentage (91.67 %) was observed for a sequence from Greece. The sequences analyzed were primarily from potato hosts (e.g., Egypt, China, Germany, South Africa, and Kazakhstan), with a few from tomato (e.g., Poland, Greece, and Bangladesh). Sequences from the United Kingdom lacked host information.
PVY-CP-D epitope
The PVY-CP-D epitope sequences obtained from Egypt, China, Czech Republic, Germany, Greece, Iran, Jordan, Kazakhstan, South Africa, Turkey, and the United Kingdom displayed 100 % identity (Table 2, Figure 1). However, some sequences from Poland (AIA59677.1, AIA59685.1, AIA59688.1, and AIA59686.1) and Bangladesh (AFO64661.1) exhibited a lower identity percentage (87.50 %). The host distribution included both potato (e.g., Egypt, China, South Africa, Poland, Kazakhstan, and Iran) and tomato (e.g., Greece and Poland). Some sequences lacked host information.
PVY-CP-F epitope
Sequences from the United Kingdom, Iran, Jordan, South Africa, Germany, Czech Republic, China, Poland, Kazakhstan, Egypt, and Bangladesh all displayed 100 % identity in the PVY-CP-F epitope (Table 2, Figure 2). The sequences were derived from both potato and tomato hosts, demonstrating the conservation of this epitope across the different species. Sequences from Turkey and the United Kingdom lacked host information.
Table 2: Identity (%) of amino acid sequences of Epitopes A, D and F derived from the Potato Virus Y coat protein of an Egyptian strain and capsid protein across multiple geographic regions and hosts with 100 % query cover.
|
Accession no. |
Countries |
Hosts |
Epitope-A |
Epitope-D |
Epitope-F |
|||
|
E value |
Identities (%) |
E value |
Identities (%) |
E value |
Identities (%) |
|||
|
ABO15902.1 |
United Kingdom |
---- |
4e-59 |
100.00 |
2e-05 |
100.00 |
8e-10 |
100.00 |
|
ABO15931.1 |
United Kingdom |
---- |
4e-59 |
100.00 |
2e-05 |
100.00 |
8e-10 |
100.00 |
|
ACF05613.1 |
Iran |
Potato |
5e-59 |
100.00 |
2e-05 |
100.00 |
8e-10 |
100.00 |
|
ACF33054.1 |
Jordan |
Potato |
3e-58 |
98.81 |
2e-05 |
100.00 |
8e-10 |
100.00 |
|
ACZ26409.1 |
South Africa |
Potato |
4e-59 |
100.00 |
2e-05 |
100.00 |
8e-10 |
100.00 |
|
ACZ26414.1 |
South Africa |
Potato |
4e-59 |
100.00 |
2e-05 |
100.00 |
8e-10 |
100.00 |
|
AFO64661.1 |
Bangladesh |
Potato |
8e-52 |
90.48 |
1e-04 |
87.50 |
8e-10 |
100.00 |
|
AFO84334.1 |
Germany |
Potato |
3e-59 |
100.00 |
2e-05 |
100.00 |
8e-10 |
100.00 |
|
AFO84345.1 |
Greece |
Tomato |
4e-54 |
91.67 |
2e-05 |
100.00 |
8e-10 |
100.00 |
|
AFO84370.1 |
Czech Republic |
Potato |
4e-59 |
100.00 |
2e-05 |
100.00 |
8e-10 |
100.00 |
|
AGU99138.1 |
China |
Potato |
3e-59 |
100.00 |
2e-05 |
100.00 |
8e-10 |
100.00 |
|
AGU99163.1 |
China |
Potato |
2e-58 |
98.81 |
2e-05 |
100.00 |
8e-10 |
100.00 |
|
AGU99182.1 |
China |
Potato |
5e-59 |
100.00 |
2e-05 |
100.00 |
8e-10 |
100.00 |
|
AIA59677.1 |
Poland |
Tomato |
8e-59 |
98.81 |
2e-05 |
100.00 |
8e-10 |
100.00 |
|
AIA59685.1 |
Poland |
Tomato |
4e-59 |
100.00 |
2e-05 |
100.00 |
8e-10 |
100.00 |
|
AIA59686.1 |
Poland |
Tomato |
3e-59 |
100.00 |
2e-05 |
100.00 |
8e-10 |
100.00 |
|
AIA59688.1 |
Poland |
Tomato |
4e-59 |
100.00 |
2e-05 |
100.00 |
8e-10 |
100.00 |
|
CAC19617.1 |
Turkey |
— |
7e-53 |
90.48 |
2e-05 |
100.00 |
8e-10 |
100.00 |
|
QFP92209.1 |
China |
Potato |
3e-59 |
100.00 |
2e-05 |
100.00 |
8e-10 |
100.00 |
|
QGR25617.1 |
Kazakhstan |
Potato |
5e-59 |
100.00 |
2e-05 |
100.00 |
8e-10 |
100.00 |
|
QKI29299.1 |
Egypt |
Potato |
2e-59 |
100.00 |
1e-04 |
87.50 |
8e-10 |
100.00 |
Table 3: Identity (%) of amino acid sequences of Epitopes G, H and I derived from the Potato Virus Y coat protein of an Egyptian strain and capsid protein across multiple geographic regions and hosts with 100 % query cover.
|
Accession no. |
Countries |
Hosts |
Epitope-G |
Epitope-H |
Epitope-I |
|||
|
E value |
Identities (%) |
E value |
Identities (%) |
E value |
Identities (%) |
|||
|
ABO15902.1 |
United Kingdom |
---- |
7e-06 |
100.00 |
0.001 |
100.00 |
7e-25 |
100.00 |
|
ABO15931.1 |
United Kingdom |
---- |
7e-06 |
100.00 |
0.001 |
100.00 |
8e-24 |
96.15 |
|
ACF05613.1 |
Iran |
Potato |
7e-06 |
100.00 |
0.001 |
100.00 |
7e-25 |
100.00 |
|
ACF33054.1 |
Jordan |
Potato |
3e-04 |
100.00 |
0.001 |
100.00 |
7e-25 |
100.00 |
|
ACZ26409.1 |
South Africa |
Potato |
7e-06 |
100.00 |
0.001 |
100.00 |
7e-25 |
100.00 |
|
ACZ26414.1 |
South Africa |
Potato |
7e-06 |
100.00 |
0.001 |
100.00 |
7e-25 |
100.00 |
|
AFO64661.1 |
Bangladesh |
Potato |
0.003 |
83.33 |
0.001 |
100.00 |
7e-25 |
100.00 |
|
AFO84334.1 |
Germany |
Potato |
7e-06 |
100.00 |
0.001 |
100.00 |
7e-25 |
100.00 |
|
AFO84345.1 |
Greece |
Tomato |
3e-04 |
100.00 |
0.001 |
100.00 |
7e-25 |
100.00 |
|
AFO84370.1 |
Czech Republic |
Potato |
7e-06 |
100.00 |
0.001 |
100.00 |
7e-25 |
100.00 |
|
AGU99138.1 |
China |
Potato |
3e-04 |
100.00 |
0.001 |
100.00 |
7e-25 |
100.00 |
|
AGU99163.1 |
China |
Potato |
7e-06 |
100.00 |
0.001 |
100.00 |
7e-25 |
100.00 |
|
AGU99182.1 |
China |
Potato |
0.003 |
83.33 |
0.001 |
100.00 |
7e-25 |
100.00 |
|
AIA59677.1 |
Poland |
Tomato |
7e-06 |
100.00 |
0.001 |
100.00 |
7e-25 |
100.00 |
|
AIA59685.1 |
Poland |
Tomato |
7e-06 |
100.00 |
0.001 |
100.00 |
7e-25 |
100.00 |
|
AIA59686.1 |
Poland |
Tomato |
0.003 |
83.33 |
0.001 |
100.00 |
7e-25 |
100.00 |
|
AIA59688.1 |
Poland |
Tomato |
7e-06 |
100.00 |
0.001 |
100.00 |
7e-25 |
100.00 |
|
CAC19617.1 |
Turkey |
— |
3e-04 |
100.00 |
0.001 |
100.00 |
7e-25 |
100.00 |
|
QFP92209.1 |
China |
Potato |
7e-06 |
100.00 |
0.001 |
100.00 |
3e-23 |
96.15 |
|
QGR25617.1 |
Kazakhstan |
Potato |
7e-06 |
100.00 |
0.001 |
100.00 |
7e-25 |
100.00 |
|
QKI29299.1 |
Egypt |
Potato |
7e-06 |
100.00 |
0.001 |
100.00 |
7e-25 |
100.00 |
PVY-CP-G epitope
The PVY-CP-G epitope exhibited 100 % identity across sequences from Egypt, Kazakhstan, China, Poland, the Czech Republic, South Africa, Iran, Turkey, Greece, Jordan, and Bangladesh (Table 3, Figure 2). However, slight reductions in identity (83.33 %) were observed in sequences from Poland (AIA59686.1), China (AGU99182.1), and Bangladesh (AFO64661.1).
PVY-CP-H epitope
The PVY-CP-H epitope sequences from the United Kingdom, Iran, Jordan, South Africa, Germany, Greece, Czech Republic, China, Poland, Kazakhstan, Egypt, and Bangladesh showed complete identity (Table 3, Figure 3). Host information was unavailable for some sequences from Turkey and the United Kingdom.
PVY-CP-I epitope
The PVY-CP-I epitope sequences from Egypt, Kazakhstan, Turkey, Poland, China, the Czech Republic, Greece, Germany, Bangladesh, South Africa, Jordan, and Iran displayed 100 % identity (Table 3, Figure 3). Slight deviations (96.15 % identity) were observed in sequences from the United Kingdom (ABO15931.1) and China (QFP92209.1).
Comparative analysis and evolutionary insights of PVY epitopes
PVY-CP-A epitope
Data in Figure 4 demonstrated the comparative alignment of variations in the amino acid sequences of Epitope-A (PVY-CP-A) derived from the CP of an Egyptian strain of PVY across multiple geographic strains and hosts. The alignment revealed notable sequence similarities and specific amino acid substitutions across the different sequences.
The majority of the sequences displayed 100 % identity with the Egyptian PVY strain (QKI29299.1), with sequences from several countries, including China (AGU99138.1, AGU99163.1, AGU99182.1), Greece (AFO84345.1), Poland (AIA59677.1, AIA59685.1, and AIA59688.1), the United Kingdom (ABO15902.1 and ABO15931.1), South Africa (ACZ26409.1 andACZ26414.1), and others showing a high degree of sequence identity (88–100 %). The alignment also showed some notable variations. The sequence from Kazakhstan (QGR25617.1) displayed the most significant variation, with twenty-two amino acid differences compared to the Egyptian strain. Similarly, the sequence from Bangladesh (AFO64661.1) exhibited mutations at positions 61-65.
PVY-CP-D, F, and G epitopes
Data in Figure 5 present the comparative alignment of variations in amino acid sequences of three epitopes (i.e., PVY-CP-D, PVY-CP-F, and PVY-CP-G) derived from the CP of an Egyptian PVY strain, analyzed across multiple geographic strains and hosts.
The PVY-CP-D epitope (positions 1-8) showed high conservation across most sequences, with only a small variation in the sequence from Bangladesh (AFO64661.1) and Poland (AIA59686.1), where the amino acid “I” appeared at position 130. The PVY-CP-F epitope (positions 1-10) exhibited remarkable conservation across the strains from multiple countries, with a single amino acid difference at position 182 in the sequence from Bangladesh (AFO64661.1). The PVY-CP-G epitope (positions 1-7) remained highly conserved across most of the analyzed sequences, with only a minor variation in the sequence from Bangladesh (AFO64661.1), where the amino acid “V” appearsed at position 193.
PVY-CP-H and I epitopes
Results in Figure 6 demonstrate a comparative alignment of variations in the amino acid sequences of two epitopes; PVY-CP-H and PVY-CP-I, derived from the CP of an Egyptian PVY strain across multiple geographic strains and hosts.
The PVY-CP-H epitope (positions 1-6) exhibited high conservation across all the analyzed strains and hosts, with no significant variations in most sequences. The PVY-CP-I epitope (positions 1-26) was also largely conserved across the strains, with a substitution observed in the Polish sequence (ABO15931.1), “X: unknown amino acid” appeared at position 263. Additionally, a variation was noted in the Chinese sequence (QFP92209.1), where “R: stands for Arginine” was present at the same position.
Discussion
In this study, we aimed to identify conserved epitopes within the Potato Virus Y (PVY) proteome to inform the design of broad-spectrum diagnostic tools and potential antigen candidates. Through comprehensive epitope mapping, several peptide regions with high conservation and immunological relevance were uncovered, suggesting their utility in enhancing both plant immune recognition and the sensitivity of PVY detection methods. These findings provide insights into viral-host interactions and offer promising targets for the development of cross-strain diagnostic assays and immune-based strategies.
Peptide 1 (positions 5-88) is particularly noteworthy due to its large size (84 amino acids), suggesting that it may function as a dominant epitope for antibody binding and immune recognition. Peptides of this length are often more effective in eliciting a T-cell response due to their ability to be processed and presented by antigen-presenting cells (APCs) (Eiz-Vesper and Schmetzer, 2020).
Peptides 2, 3, 4, 5, 7, and 8 (ranging from 1 to 10 amino acids) are significantly shorter. These peptides might play an essential role in inducing specific antibody responses or may act as minimal epitopes for T-cell recognition. Shorter peptides are generally known to bind tightly to the MHC molecules, facilitating more efficient immune response activation (Perez et al., 2022; Wu et al., 2023; Song et al., 2024).
Peptide 9 (positions 238-263) is another notable sequence, as it spans 26 amino acids, contributing to antigenic properties through its involvement in both T- and B-cell interactions. Peptides of this length may present a balance between immunogenicity and the ability to form stable complexes with the MHC molecules (Wieczorek et al., 2017).
The identification of these epitopes is significant for vaccine development, as targeting these regions enhances the immune system’s ability to recognize and eliminate the virus. In particular, epitopes such as peptide 1 (84 amino acids) could be used in the design of vaccines, which focus on inducing both humoral (antibody-mediated) and cellular (T-cell-mediated) immune responses. The shorter peptides (e.g., peptides 2, 3, 4, 5) might also be suitable for inclusion in peptide-based vaccines aimed at stimulating specific immune responses against the virus (Malonis et al., 2019).
Additionally, these findings underscore the importance of the CP as a critical antigenic target. Previous studies have shown that the viral CP plays a key role in immune evasion, and identifying specific epitopes within this protein could pave the way for more targeted therapeutic strategies (Lindbo and Falk, 2017). Further validation of these epitopes using in vivo models and their ability to bind to the MHC molecules is essential for the development of epitope-based vaccines.
These current findings underscore the genetic stability of PVY and its potential for cross-region diagnosis and control. The observed conservation of these epitopes across multiple PVY strains reinforces their potential as targets for diagnostic tools and control strategies aimed at managing PVY infections globally (Gibbs et al., 2017). This supports several previous studies highlighting the importance of these epitopes in PVY’s structural integrity and viral function (Quenouille et al., 2013; Trovato et al., 2020).
The high identity percentages observed in the analyzed PVY epitope regions indicate significant conservation across the diverse geographic locations and host plants, suggesting that these epitopes play critical roles in PVY’s structural integrity and host-virus interactions. The PVY-CP-A epitope exhibited remarkable conservation with most sequences showing 100 % identity. The few variations, such as the 91.67 % identity observed in a Greek sequence, could reflect regional adaptations. This stability highlights the epitope’s potential as a target for diagnostic tools and control measures (Moury et al., 2017).
Similarly, the PVY-CP-D epitope displayed 100 % identity in most sequences, with slight variations observed in Poland and Bangladesh (87.50 %). These minor differences might be attributed to regional strain evolution or host interactions (Cuevas et al., 2012). The presence of sequences from both potato and tomato underscores the virus’s polyphagous nature (Karasev and Gray, 2013a). The complete conservation of the PVY-CP-F epitope across multiple regions reinforces its importance in viral stability and host interactions. The absence of significant variations suggests that this region is under strong evolutionary pressure to remain unchanged, making it an ideal target for universal diagnostic methods (Tsedaley, 2015).
Epitope-G showed high conservation across most samples, with a few sequences from Poland, China, and Bangladesh exhibiting reduced identity (83.33 %). These differences might indicate ongoing evolutionary adaptations, warranting further investigation into their impact on pathogenicity and host interactions (Revers and García, 2015).
The PVY-CP-H epitope was completely conserved across all the analyzed regions. This consistency supports its essential role in viral fitness and adaptability across different host plants. The presence of sequences without host information suggests that some studies focused solely on viral genetic material rather than host specificity (Lefeuvre et al., 2019).
The PVY-CP-I epitope displayed the highest degree of conservation, with nearly all sequences exhibiting 100 % identity. The minor variations observed in sequences from the United Kingdom and China may represent adaptive changes, but the overall stability of this epitope indicates its importance for viral survival. Its conservation makes it a promising target for broad-spectrum control strategies (Elena et al., 2014; Lacomme and Jacquot, 2017).
The comparative analysis of PVY CP epitopes across various geographic strains and hosts provides crucial insights into the evolutionary dynamics and functional significance of these regions. The high degree of conservation observed in most epitopes indicates that these regions play a pivotal role in the viral life cycle, contributing to structural stability, host interactions, and/ or immune evasion.
The conservation of PVY-CP-A, PVY-CP-D, PVY-CP-F, PVY-CP-G, PVY-CP-H, and PVY-CP-I across the diverse geographic strains highlights their potential functional constraints. Such conservation is indicative of evolutionary pressure to maintain these regions for essential viral functions, such as stability, host receptor binding, or immune system evasion (Moury et al., 2017). The observed 88-100 % sequence identity across the multiple countries and host plants further underscores the significance of these epitopes in PVY pathogenicity and transmission. The observed strong conservation also suggests that these epitopes could be exploited for broad-spectrum detection tools or vaccine development.
Despite the overall conservation, some regional and host-specific variations were identified. The strain from Kazakhstan (QGR25617.1) exhibited the most significant divergence in PVY-CP-A, recording 22 amino acid differences compared to the Egyptian strain, indicating local adaptation or evolutionary divergence due to environmental factors. Similarly, minor substitutions in sequences from Bangladesh (AFO64661.1) and Poland (AIA59686.1) suggest the potential influence of regional agricultural practices, host resistance mechanisms, or environmental selection pressures. These findings align with several previous studies highlighting the genetic plasticity of PVY, enabling it to adapt to different environmental conditions and hosts (Karasev and Gray, 2013b; Green et al., 2018).
The presence of conserved epitopes across both potato and tomato hosts indicates the broad host range of PVY and its ability to maintain key functional regions despite adapting to different plant species. The minor variations observed, such as those in PVY-CP-D and PVY-CP-G from Bangladesh may reflect localized evolutionary pressures influencing virulence, host specificity, or immune escape strategies (Revers and García, 2015). Understanding these minor but potentially significant mutations could help predict the emerging PVY variants with altered pathogenicity or resistance to existing management strategies (Gibbs et al., 2020).
The high degree of sequence conservation in these epitopes suggests their utility in developing universal diagnostic tools. Since epitopes such as PVY-CP-F and PVY-CP-H exhibit minimal sequence variation, they could serve as reliable targets for serological assays like ELISA or molecular detection methods such as polymerase chain reaction (PCR) (MacKenzie et al., 2015; Lacomme and Jacquot, 2017). Furthermore, their conservation makes them promising candidates for monoclonal antibody-based detection strategies or epitope-based vaccine development, providing broad-spectrum protection against PVY infections.
Conclusions and Recommendations
This study highlights the high conservation of key epitopes within the CP of Potato virus Y (PVY) across diverse geographic regions and host species. These conserved epitopes, including PVY-CP-A, -D, -F, -G, -H, and -I are crucial for the virus’s structural integrity and infectivity. Minor sequence variations observed in specific viral strains suggest local adaptations, reinforcing PVY’s ability to evolve in response to environmental pressures. The current findings underscore the potential of using these epitopes as targets for developing universal diagnostic tools and vaccines, offering promising strategies for broad-spectrum management of PVY infections in agriculture. This study recommends using the highly conserved PVY coat protein epitopes, especially PVY-CP-A, -H, and -I, as targets for developing broad-spectrum diagnostic tools and resistance strategies. Regular monitoring of variable epitopes, such as PVY-CP-G, is advised to detect the region-specific adaptations. Expanding the analysis to include more diverse geographic isolates and combining sequence data with structural and immunological modeling will enhance the understanding of PVY evolution.
Acknowledgment
We sincerely appreciate Miss ElShymaa Tarek Abdel-Aziz Ahmed for her outstanding contributions to motif prediction. Her expertise, dedication, and hard work were invaluable to the success of this study.
Novelty Statement
This study presents the first comprehensive mapping of conserved epitopes across the PVY proteome, identifying candidate peptides with strong immunogenic potential. By highlighting the regions suitable for the broad-spectrum antigen design, our findings lay the groundwork for next-generation diagnostic tools and immune-based interventions in plant virus management.
Author’s Contribution
AHA: Methodology, data collection, data analysis, writing the original draft.
MKA: Conceptualization, data analysis, revision and editing of the manuscript.
ASS: Design and data analysis, revision and editing of the manuscript.
AAM: Data collection, data analysis, revision and editing of the manuscript.
Funding source
This study received no external funding.
Ethical approval
Ethical approval was not necessary for this study, as it is entirely computational and does not involve human participants, animals, or living plants.
Conflict of interests
The authors have declared no conflicts of interest.
References
Afridi, S., Hoessli, D.C. and Hameed, M.W., 2016. Mechanistic understanding and significance of small peptides interaction with MHC class II molecules for therapeutic applications. Immunol. Rev., 272(1): 151-168. https://doi.org/10.1111/imr.12435
Ali, A., 2024. Potato virus Y. In: Viral diseases of field and horticultural crops. Academic Press. pp. 347-351. https://doi.org/10.1016/B978-0-323-90899-3.00040-9
Anikina, I., Kamarova, A., Issayeva, K., Issakhanova, S., Mustafayeva, N., Insebayeva, M., Insebayeva, M., Mukhamedzhanova, A., Khan, S.M., Ahmad, Z., Lho, L.H., Han, H. and Raposo, A., 2023. Plant protection from virus: A review of different approaches. Front. Plant Sci., 14: 1163270. https://doi.org/10.3389/fpls.2023.1163270
Bai, Y., Han, S., Gao, Y., Zhang, W., Fan, G., Qiu, C., Nie, X. and Wen, J., 2019. Genetic diversity of potato virus y in potato production areas in Northeast China. Plant Dis., 103(2): 289-297. https://doi.org/10.1094/PDIS-04-18-0687-RE
Belabess, Z., Tahiri, A. and Lahlali, R., 2024. Contemporary perspectives on the global evolution of potato virus Y pathogen. Indian Phytopathol., 77(1): 13-34. https://doi.org/10.1007/s42360-024-00709-1
Berindean, I.V., Taoutaou, A., Rida, S., Ona, A.D., Stefan, M.F., Costin, A., Racz, I. and Muntean, L., 2024. Modern breeding strategies and tools for durable late blight resistance in potato. Plants, 13(12): 1711. https://doi.org/10.3390/plants13121711
Bhoi, T.K., Samal, I., Majhi, P.K., Komal, J., Mahanta, D.K., Pradhan, A.K., Saini, M.V., Raj, N., Ahmad, M.A., Behera, P.P. and Ashwini, M., 2022. Insight into aphid mediated PVY transmission: A molecular to bioinformatics prospective. Front. Microbiol., 13: 1001454. https://doi.org/10.3389/fmicb.2022.1001454
Chikh-Ali, M. and Karasev, A.V., 2023. Virus diseases of potato and their control. In: Potato production worldwide. Academic Press. pp. 199-212. https://doi.org/10.1016/B978-0-12-822925-5.00008-6
Croft, N. P., Smith, S. A., Pickering, J., Sidney, J., Peters, B., Faridi, P., Witney, M.J., Sebastian, P., Flesch, I.E.A., Sally L.H., Sette, A., La Gruta, N.L., Purcell, A. and Tscharke, D.C., 2019. Most viral peptides displayed by class I MHC on infected cells are immunogenic. Proc. Natl. Acad. Sci., 116(8): 3112-3117. https://doi.org/10.1073/pnas.1815239116
Cuevas, J.M., Delaunay, A., Rupar, M., Jacquot, E. and Elena, S.F., 2012. Molecular evolution and phylogeography of potato virus Y based on the CP gene. J. Gen. Virol., 93(11): 2496-2501. https://doi.org/10.1099/vir.0.044347-0
Dupuis, B., Nkuriyingoma, P. and Ballmer, T., 2024. Economic impact of PVY (PVY) in Europe. Potato Res., 67(1): 55-72. https://doi.org/10.1007/s11540-023-09623-x
Eiz-Vesper, B. and Schmetzer, H.M., 2020. Antigen-presenting cells: Potential of proven und new players in immune therapies. Transf. Med. Hemother., 47(6): 429-431. https://doi.org/10.1159/000512729
Elena, S.F., Fraile, A. and García-Arenal, F., 2014. Evolution and emergence of plant viruses. Adv. Virus Res., 88: 161-191. https://doi.org/10.1016/B978-0-12-800098-4.00003-9
Gibbs, A.J., Hajizadeh, M., Ohshima, K. and Jones, R.A., 2020. The potyviruses: An evolutionary synthesis is emerging. Viruses, 12(2): 132. https://doi.org/10.3390/v12020132
Gibbs, A.J., Ohshima, K., Yasaka, R., Mohammadi, M., Gibbs, M.J. and Jones, R.A., 2017. The phylogenetics of the global population of potato virus Y and its necrogenic recombinants. Virus Evol., 3(1): p.vex002. https://doi.org/10.1093/ve/vex002
Green, K.J., Brown, C.J. and Karasev, A.V., 2018. Genetic diversity of potato virus Y (PVY): Sequence analyses reveal ten novel PVY recombinant structures. Arch. Virol., 163(1): 23-32. https://doi.org/10.1007/s00705-017-3568-x
Karasev, A.V. and Gray, S.M., 2013a. Continuous and emerging challenges of potato virus Y in potato. Ann. Rev. Phytopathol., 51(1): 571-586. https://doi.org/10.1146/annurev-phyto-082712-102332
Karasev, A.V. and Gray, S.M., 2013b. Genetic diversity of Potato virus Y complex. Am. J. Potato Res., 90: 7-13. https://doi.org/10.1007/s12230-012-9287-7
Kassim, N.A., Nerway, Z.A.A. and Yousif, K.H., 2014. Identification of Potato virus Y (PVY) and its economic importance on potato crop. Sci. J. Univ. Zakho, 2(2): 304-309. https://sjuoz.uoz.edu.krd/index.php/sjuoz/article/view/234. https://doi.org/10.25271/2014.2.2.210
Kreiter, S., Vormehr, M., Van de Roemer, N., Diken, M., Löwer, M., Diekmann, J., Boegel S., Schrörs, B., Vascotto, F., Castle, J.C., Tadmor, A.D., Schoenberger, S.P., Huber, C., Türeci, Ö. and Sahin, U., 2015. Mutant MHC class II epitopes drive therapeutic immune responses to cancer. Nature, 520(7549): 692-696. https://doi.org/10.1038/nature14426
Lacomme, C. and Jacquot, E., 2017. General characteristics of Potato virus Y (PVY) and its impact on potato production: An overview. Potato virus Y: Biodiversity, pathogenicity, epidemiology and management, pp. 1-19. https://doi.org/10.1007/978-3-319-58860-5_1
Lee, J., Lee, S.K., Park, J.S. and Lee, K.R., 2023. Plant-made pharmaceuticals: Exploring studies for the production of recombinant protein in plants and assessing challenges ahead. Plant Biotechnol. Rep., 17(1): 53-65. https://doi.org/10.1007/s11816-023-00821-0
Lefeuvre, P., Martin, D.P., Elena, S.F., Shepherd, D.N., Roumagnac, P. and Varsani, A., 2019. Evolution and ecology of plant viruses. Nat. Rev. Microbiol., 17(10): 632-644. https://www.nature.com/articles/s41579-019-0232-3.
Li, X., Wang, Y., Wu, H., Wu, S., Zhao, C., Wang, Z., Song, B. and Song, R. 2025. Virtual screening of potato virus Y coat protein for discovering lead inhibitor of viral intercellular traffic. Pestic. Biochem. Physiol., pp. 106553. https://doi.org/10.1016/j.pestbp.2025.106553
Lindbo, J.A. and Falk, B.W., 2017. The impact of coat protein-mediated virus resistance in applied plant pathology and basic research. Phytopathology, 107(6): 624-634. https://doi.org/10.1094/PHYTO-12-16-0442-RVW
Liu, J. Z., Li, F. and Liu, Y., 2017. Plant immunity against viruses. Front. Microbiol., 8: 520. https://doi.org/10.3389/fmicb.2017.00520
Machado-Assefh, C.R., Said-Adamo, M.D.M., Cortéz, S.D., Gialdi, A.I.L., Isasmendi, G.L., Ortego, J. and Alvarez, A.E., 2023. Newly recorded plant-aphid associations: Implications for PLRV and PVY control in potato crops. Crop Protection, 167: 106202. https://doi.org/10.1016/j.cropro.2023.106202
MacKenzie, T.D., Nie, X. and Singh, M., 2015. RT-PCR and real-time RT-PCR methods for the detection of potato virus Y in potato leaves and tubers. Plant Virol. Protocols New Approaches Detect Viruses and Host Responses, pp. 13-26. https://doi.org/10.1007/978-1-4939-1743-3_2
Malonis, R.J., Lai, J.R. and Vergnolle, O., 2019. Peptide-based vaccines: Current progress and future challenges. Chem. Rev., 120(6): 3210-3229. https://doi.org/10.1021/acs.chemrev.9b00472
Moury, B., Simon, V., Faure, C., Svanella-Dumas, L., Marais, A. and Candresse, T., 2017. Host groups of Potato virus Y: Vanishing barriers. Potato virus Y: Biodiversity, pathogenicity, epidemiology and management, pp. 243-261. https://doi.org/10.1007/978-3-319-58860-5_9
Nimisha, Chaubey, R. and Srivastava, Y. 2024. Peptide-based vaccines in cancer immunotherapy. In: Sharma, R., Pandey, V., Mishra, N. (eds) Nanotechnology based strategies for cancer immunotherapy. Springer, Singapore. https://doi.org/10.1007/978-981-97-7022-9_7
Perez, M.A., Cuendet, M.A., Röhrig, U.F., Michielin, O. and Zoete, V., 2022. Structural prediction of peptide–MHC binding modes. Comput. Peptide Sci. Methods Protocols, pp. 245-282. https://doi.org/10.1007/978-1-0716-1855-4_13
Pitt, W.J., Cooper, W.R., Pouchnik, D., Headrick, H. and Nachappa, P., 2024. High-throughput molecular gut content analysis of aphids identifies plants relevant for potato virus Y epidemiology. Insect Sci., 31(5): 1489-1502. https://doi.org/10.1111/1744-7917.13327
Quenouille, J., Vassilakos, N. and Moury, B., 2013. Potato virus Y: A major crop pathogen that has provided major insights into the evolution of viral pathogenicity. Mol. Plant Pathol., 14(5): 439-452. https://doi.org/10.1111/mpp.12024
Revers, F. and García, J.A., 2015. Molecular biology of potyviruses. Adv. Virus Res., 92: 101-199. https://doi.org/10.1016/bs.aivir.2014.11.006
Rich, R.R. and Chaplin, D.D., 2019. The human immune response. In: Clinical Immunology. Elsevier. pp. 3-17. https://doi.org/10.1016/B978-0-7020-6896-6.00001-6
Rock, K.L., Reits, E. and Neefjes, J., 2016. Present yourself! By MHC class I and MHC class II molecules. Trends Immunol., 37(11): 724-737. https://doi.org/10.1016/j.it.2016.08.010
Rosendahl, H.S., van Beek, J., de Jonge, J., Luytjes, W. and van Baarle, D. 2014. T cell responses to viral infections–opportunities for peptide vaccination. Front. Immunol., 5: 171. https://doi.org/10.3389/fimmu.2014.00171
Rushton, J., Larsen, B., Houser, A., Pitt, W.J., Charkowski, A.O., Chikh-Ali, M. and Nalam, V.J., 2024. Detection and characterization of potato virus Y (PVY) strains and mixed infections in San Luis Valley, Colorado. PhytoFrontiers™, 4(4): 746-759. https://doi.org/10.1094/PHYTOFR-03-24-0028-R
Sheibani, N., Arab, S.S. and Kamalvand, M., 2023. The coat protein of tobacco mosaic virus as an anti-tobacco mosaic virus: A molecular dynamics simulation. J. Biomol. Struct. Dyn., 41(23): 13792-13797. https://doi.org/10.1080/07391102.2023.2183036
Sheibani, N., Arab, S.S. and Kamalvand, M., 2024. Designing a recombinant coat protein to reduce tobacco mosaic virus infection in plants. J. Biomol. Struct. Dyn., pp. 1-7. https://doi.org/10.1080/07391102.2024.2430456
Song, X., Li, Y., Wu, H., Qiu, H.J. and Sun, Y., 2024. T-cell epitope-based vaccines: A promising strategy for prevention of infectious diseases. Vaccines, 12(10): 1181. https://doi.org/10.3390/vaccines12101181
Tian, Y.P., Hepojoki, J., Ranki, H., Lankinen, H. and Valkonen, J.P., 2014. Analysis of PVY coat protein epitopes recognized by three commercial monoclonal antibodies. PLoS One, 9(12): e115766. https://doi.org/10.1371/journal.pone.0115766
Trovato, M., Sartorius, R., D’Apice, L., Manco, R. and De Berardinis, P., 2020. Viral emerging diseases: challenges in developing vaccination strategies. Front. Immunol., 11: 2130. https://doi.org/10.3389/fimmu.2020.02130
Tsedaley, B., 2015. A review paper on Potato virus Y (PVY) biology, economic importance and its managements. J. Biol. Agric. Healthc., 5(9): 110-126.
Verma, R.K., Mishra, R. and Gaur, R.K., 2016. Potato virus Y genetic variability: A review. Plant Viruses: Evolution and Management, pp. 205-214. https://doi.org/10.1007/978-981-10-1406-2_12
Vita, R., Mahajan, S., Overton, J.A., Dhanda, S.K., Martini, S., Cantrell, J.R., Daniel, K., Wheeler, D.K., Sette, A. and Peters, B., 2019. The immune epitope database (IEDB): 2018 update. Nucl. Acids Res., 47(D1): D339-D343. https://doi.org/10.1093/nar/gky1006
Wieczorek, M., Abualrous, E.T., Sticht, J., Álvaro-Benito, M., Stolzenberg, S., Noé, F. and Freund, C. 2017. Major histocompatibility complex (MHC) class I and MHC class II proteins: Conformational plasticity in antigen presentation. Front. Immunol., 8: 292. https://doi.org/10.3389/fimmu.2017.00292
Wu, X., Li, T., Jiang, R., Xin, Y.X., Hongqian, G.H. and Rong, Y.R., 2023. Targeting MHC-I molecules for cancer: function, mechanism, and therapeutic prospects. Mol. Cancer, 22: 194. https://doi.org/10.1186/s12943-023-01899-4
Zhang, S., Wei, C., Yu, L. and Song, B., 2023. Vanisulfane induced plant resistance toward PVY via the salicylic-depended acid signaling pathway. J. Agric. Food Chem., 71(40): 14527-14538. https://doi.org/10.1021/acs.jafc.3c05838